SMYD5,NN8-4AG,RAI15
  • SMYD5,NN8-4AG,RAI15

Anti-SMYD5 Antibody 100ul

Ref: AN-HPA015514-100ul
Anti-SMYD5

Información del producto

Polyclonal Antibody against Human SMYD5, Gene description: SMYD family member 5, Alternative Gene Names: NN8-4AG, RAI15, RRG1, ZMYND23, Validated applications: ICC, IHC, Uniprot ID: Q6GMV2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SMYD5
Gene Description SMYD family member 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QLELLRRLFTEALYEEAVSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWVHACDTLELKPQDREQLDAFIDQLYKDIEAATGEFLNCEGSGLFVLQSCC
Immunogen QLELLRRLFTEALYEEAVSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWVHACDTLELKPQDREQLDAFIDQLYKDIEAATGEFLNCEGSGLFVLQSCC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NN8-4AG, RAI15, RRG1, ZMYND23
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6GMV2
HTS Code 3002150000
Gene ID 10322
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SMYD5 Antibody 100ul

Anti-SMYD5 Antibody 100ul