GDF10,BMP-3b
  • GDF10,BMP-3b

Anti-GDF10 Antibody 100ul

Ref: AN-HPA015498-100ul
Anti-GDF10

Información del producto

Polyclonal Antibody against Human GDF10, Gene description: growth differentiation factor 10, Alternative Gene Names: BMP-3b, Validated applications: IHC, Uniprot ID: P55107, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GDF10
Gene Description growth differentiation factor 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEKTMQKA
Immunogen ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEKTMQKA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BMP-3b
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55107
HTS Code 3002150000
Gene ID 2662
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GDF10 Antibody 100ul

Anti-GDF10 Antibody 100ul