CDH20,Cdh7,CDH7L3
  • CDH20,Cdh7,CDH7L3

Anti-CDH20 Antibody 100ul

Ref: AN-HPA015490-100ul
Anti-CDH20

Información del producto

Polyclonal Antibody against Human CDH20, Gene description: cadherin 20, type 2, Alternative Gene Names: Cdh7, CDH7L3, Validated applications: IHC, Uniprot ID: Q9HBT6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CDH20
Gene Description cadherin 20, type 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PFQDTTTVHISVEDVDEPPVFEPGFYFVEVPEDVAIGTTIQIISAKDPDVTNNSIRYSIDRSSDPGRFFYVDITTGALMTARPLDREEFSWHNITVLAMEMNNPSQVGSVPVTIKV
Immunogen PFQDTTTVHISVEDVDEPPVFEPGFYFVEVPEDVAIGTTIQIISAKDPDVTNNSIRYSIDRSSDPGRFFYVDITTGALMTARPLDREEFSWHNITVLAMEMNNPSQVGSVPVTIKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Cdh7, CDH7L3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HBT6
HTS Code 3002150000
Gene ID 28316
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CDH20 Antibody 100ul

Anti-CDH20 Antibody 100ul