IL1RL2,IL1R-rp2
  • IL1RL2,IL1R-rp2

Anti-IL1RL2 Antibody 100ul

Ref: AN-HPA015485-100ul
Anti-IL1RL2

Información del producto

Polyclonal Antibody against Human IL1RL2, Gene description: interleukin 1 receptor-like 2, Alternative Gene Names: IL1R-rp2, IL1RRP2, Validated applications: IHC, Uniprot ID: Q9HB29, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IL1RL2
Gene Description interleukin 1 receptor-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQLGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNITFLEVKMEDYGLPFMCHAG
Immunogen QAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQLGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNITFLEVKMEDYGLPFMCHAG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IL1R-rp2, IL1RRP2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HB29
HTS Code 3002150000
Gene ID 8808
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IL1RL2 Antibody 100ul

Anti-IL1RL2 Antibody 100ul