NDRG4,KIAA1180
  • NDRG4,KIAA1180

Anti-NDRG4 Antibody 25ul

Ref: AN-HPA015313-25ul
Anti-NDRG4

Información del producto

Polyclonal Antibody against Human NDRG4, Gene description: NDRG family member 4, Alternative Gene Names: KIAA1180, SMAP-8, Validated applications: IHC, WB, Uniprot ID: Q9ULP0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NDRG4
Gene Description NDRG family member 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence RQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLP
Immunogen RQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1180, SMAP-8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULP0
HTS Code 3002150000
Gene ID 65009
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NDRG4 Antibody 25ul

Anti-NDRG4 Antibody 25ul