CACFD1,C9orf7
  • CACFD1,C9orf7

Anti-CACFD1 Antibody 100ul

Ref: AN-HPA015280-100ul
Anti-CACFD1

Información del producto

Polyclonal Antibody against Human CACFD1, Gene description: calcium channel flower domain containing 1, Alternative Gene Names: C9orf7, D9S2135, flower, Validated applications: ICC, WB, Uniprot ID: Q9UGQ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CACFD1
Gene Description calcium channel flower domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLE
Immunogen NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf7, D9S2135, flower
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UGQ2
HTS Code 3002150000
Gene ID 11094
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CACFD1 Antibody 100ul

Anti-CACFD1 Antibody 100ul