TES,DKFZP586B2022
  • TES,DKFZP586B2022

Anti-TES Antibody 25ul

Ref: AN-HPA015269-25ul
Anti-TES

Información del producto

Polyclonal Antibody against Human TES, Gene description: testis derived transcript (3 LIM domains), Alternative Gene Names: DKFZP586B2022, TESS-2, TESTIN, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UGI8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TES
Gene Description testis derived transcript (3 LIM domains)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence QLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVD
Immunogen QLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP586B2022, TESS-2, TESTIN
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UGI8
HTS Code 3002150000
Gene ID 26136
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TES Antibody 25ul

Anti-TES Antibody 25ul