ADCY10,HCA2
  • ADCY10,HCA2

Anti-ADCY10 Antibody 25ul

Ref: AN-HPA015243-25ul
Anti-ADCY10

Información del producto

Polyclonal Antibody against Human ADCY10, Gene description: adenylate cyclase 10 (soluble), Alternative Gene Names: HCA2, RP1-313L4.2, SAC, SACI, Sacy, Validated applications: IHC, Uniprot ID: Q96PN6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ADCY10
Gene Description adenylate cyclase 10 (soluble)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSW
Immunogen NLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HCA2, RP1-313L4.2, SAC, SACI, Sacy
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96PN6
HTS Code 3002150000
Gene ID 55811
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ADCY10 Antibody 25ul

Anti-ADCY10 Antibody 25ul