PLPPR1,FLJ20300
  • PLPPR1,FLJ20300

Anti-PLPPR1 Antibody 25ul

Ref: AN-HPA014968-25ul
Anti-PLPPR1

Información del producto

Polyclonal Antibody against Human PLPPR1, Gene description: phospholipid phosphatase related 1, Alternative Gene Names: FLJ20300, LPPR1, MGC26189, PRG-3, Validated applications: IHC, Uniprot ID: Q8TBJ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PLPPR1
Gene Description phospholipid phosphatase related 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KSTRESLIAQEKTILTGECCYLNPLLRRIIRF
Immunogen KSTRESLIAQEKTILTGECCYLNPLLRRIIRF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20300, LPPR1, MGC26189, PRG-3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TBJ4
HTS Code 3002150000
Gene ID 54886
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PLPPR1 Antibody 25ul

Anti-PLPPR1 Antibody 25ul