MPDU1,CDGIf,Lec35
  • MPDU1,CDGIf,Lec35

Anti-MPDU1 Antibody 100ul

Ref: AN-HPA014845-100ul
Anti-MPDU1

Información del producto

Polyclonal Antibody against Human MPDU1, Gene description: mannose-P-dolichol utilization defect 1, Alternative Gene Names: CDGIf, Lec35, PQLC5, SL15, Validated applications: ICC, IHC, WB, Uniprot ID: O75352, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MPDU1
Gene Description mannose-P-dolichol utilization defect 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
Immunogen AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CDGIf, Lec35, PQLC5, SL15
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75352
HTS Code 3002150000
Gene ID 9526
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MPDU1 Antibody 100ul

Anti-MPDU1 Antibody 100ul