MLPH,exophilin-3
  • MLPH,exophilin-3

Anti-MLPH Antibody 25ul

Ref: AN-HPA014685-25ul
Anti-MLPH

Información del producto

Polyclonal Antibody against Human MLPH, Gene description: melanophilin, Alternative Gene Names: exophilin-3, l(1)-3Rk, l1Rk3, ln, Slac-2a, Validated applications: IHC, Uniprot ID: Q9BV36, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MLPH
Gene Description melanophilin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFL
Immunogen ELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names exophilin-3, l(1)-3Rk, l1Rk3, ln, Slac-2a
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BV36
HTS Code 3002150000
Gene ID 79083
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MLPH Antibody 25ul

Anti-MLPH Antibody 25ul