MARCH8,c-MIR
  • MARCH8,c-MIR

Anti-MARCH8 Antibody 100ul

Ref: AN-HPA014597-100ul
Anti-MARCH8

Información del producto

Polyclonal Antibody against Human MARCH8, Gene description: membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase, Alternative Gene Names: c-MIR, MARCH-VIII, MIR, RNF178, Validated applications: IHC, WB, Uniprot ID: Q5T0T0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MARCH8
Gene Description membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGHGICHSDTNSSCCTEPEDTGAEIIHV
Immunogen VQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGHGICHSDTNSSCCTEPEDTGAEIIHV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names c-MIR, MARCH-VIII, MIR, RNF178
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T0T0
HTS Code 3002150000
Gene ID 220972
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MARCH8 Antibody 100ul

Anti-MARCH8 Antibody 100ul