CD300C,CMRF-35A
  • CD300C,CMRF-35A

Anti-CD300C Antibody 25ul

Ref: AN-HPA014523-25ul
Anti-CD300C

Información del producto

Polyclonal Antibody against Human CD300C, Gene description: CD300c molecule, Alternative Gene Names: CMRF-35A, CMRF35, CMRF35A, IGSF16, LIR, Validated applications: IHC, WB, Uniprot ID: Q08708, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CD300C
Gene Description CD300c molecule
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Immunogen PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CMRF-35A, CMRF35, CMRF35A, IGSF16, LIR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q08708
HTS Code 3002150000
Gene ID 10871
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CD300C Antibody 25ul

Anti-CD300C Antibody 25ul