NEMP1,KIAA0286
  • NEMP1,KIAA0286

Anti-NEMP1 Antibody 100ul

Ref: AN-HPA014394-100ul
Anti-NEMP1

Información del producto

Polyclonal Antibody against Human NEMP1, Gene description: nuclear envelope integral membrane protein 1, Alternative Gene Names: KIAA0286, TMEM194, TMEM194A, Validated applications: ICC, IHC, WB, Uniprot ID: O14524, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NEMP1
Gene Description nuclear envelope integral membrane protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIYEEASSEEEDSYSRCPAITQNNF
Immunogen LCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIYEEASSEEEDSYSRCPAITQNNF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0286, TMEM194, TMEM194A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14524
HTS Code 3002150000
Gene ID 23306
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NEMP1 Antibody 100ul

Anti-NEMP1 Antibody 100ul