OPALIN,HTMP10
  • OPALIN,HTMP10

Anti-OPALIN Antibody 100ul

Ref: AN-HPA014372-100ul
Anti-OPALIN

Información del producto

Polyclonal Antibody against Human OPALIN, Gene description: oligodendrocytic myelin paranodal and inner loop protein, Alternative Gene Names: HTMP10, TMEM10, TMP10, Validated applications: IHC, Uniprot ID: Q96PE5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OPALIN
Gene Description oligodendrocytic myelin paranodal and inner loop protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RRRSSIEAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSLE
Immunogen RRRSSIEAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HTMP10, TMEM10, TMP10
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96PE5
HTS Code 3002150000
Gene ID 93377
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OPALIN Antibody 100ul

Anti-OPALIN Antibody 100ul