MILR1,Allergin-1
  • MILR1,Allergin-1

Anti-MILR1 Antibody 25ul

Ref: AN-HPA014347-25ul
Anti-MILR1

Información del producto

Polyclonal Antibody against Human MILR1, Gene description: mast cell immunoglobulin like receptor 1, Alternative Gene Names: Allergin-1, C17orf60, MCA-32, Validated applications: IHC, Uniprot ID: Q7Z6M3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MILR1
Gene Description mast cell immunoglobulin like receptor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLP
Immunogen RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Allergin-1, C17orf60, MCA-32
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z6M3
HTS Code 3002150000
Gene ID 284021
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MILR1 Antibody 25ul

Anti-MILR1 Antibody 25ul