FDCSP,C4orf7,FDC-SP
  • FDCSP,C4orf7,FDC-SP

Anti-FDCSP Antibody 100ul

Ref: AN-HPA014326-100ul
Anti-FDCSP

Información del producto

Polyclonal Antibody against Human FDCSP, Gene description: follicular dendritic cell secreted protein, Alternative Gene Names: C4orf7, FDC-SP, Validated applications: IHC, Uniprot ID: Q8NFU4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FDCSP
Gene Description follicular dendritic cell secreted protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPL
Immunogen KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4orf7, FDC-SP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NFU4
HTS Code 3002150000
Gene ID 260436
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FDCSP Antibody 100ul

Anti-FDCSP Antibody 100ul