DPCR1,bCX105N19.6
  • DPCR1,bCX105N19.6
Atlas Antibodies

Anti-DPCR1 Antibody 100ul

Ref: AN-HPA014036-100ul
Anti-DPCR1

Información del producto

Polyclonal Antibody against Human DPCR1, Gene description: diffuse panbronchiolitis critical region 1, Alternative Gene Names: bCX105N19.6, PBLT, Validated applications: IHC, Uniprot ID: Q3MIW9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DPCR1
Gene Description diffuse panbronchiolitis critical region 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQK
Immunogen KTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bCX105N19.6, PBLT
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q3MIW9
HTS Code 3002150000
Gene ID 135656
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje

Anti-DPCR1 Antibody 100ul

Anti-DPCR1 Antibody 100ul