SLC6A9,GLYT1
  • SLC6A9,GLYT1

Anti-SLC6A9 Antibody 100ul

Ref: AN-HPA013977-100ul
Anti-SLC6A9

Información del producto

Polyclonal Antibody against Human SLC6A9, Gene description: solute carrier family 6 (neurotransmitter transporter, glycine), member 9, Alternative Gene Names: GLYT1, Validated applications: ICC, IHC, Uniprot ID: P48067, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC6A9
Gene Description solute carrier family 6 (neurotransmitter transporter, glycine), member 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence YCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE
Immunogen YCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GLYT1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P48067
HTS Code 3002150000
Gene ID 6536
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC6A9 Antibody 100ul

Anti-SLC6A9 Antibody 100ul