ADGRE5,CD97,TM7LN1
  • ADGRE5,CD97,TM7LN1

Anti-ADGRE5 Antibody 100ul

Ref: AN-HPA013707-100ul
Anti-ADGRE5

Información del producto

Polyclonal Antibody against Human ADGRE5, Gene description: adhesion G protein-coupled receptor E5, Alternative Gene Names: CD97, TM7LN1, Validated applications: IHC, Uniprot ID: P48960, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ADGRE5
Gene Description adhesion G protein-coupled receptor E5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ
Immunogen RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD97, TM7LN1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P48960
HTS Code 3002150000
Gene ID 976
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ADGRE5 Antibody 100ul

Anti-ADGRE5 Antibody 100ul