OS9,ERLEC2,OS-9
  • OS9,ERLEC2,OS-9

Anti-OS9 Antibody 25ul

Ref: AN-HPA013694-25ul
Anti-OS9

Información del producto

Polyclonal Antibody against Human OS9, Gene description: osteosarcoma amplified 9, endoplasmic reticulum lectin, Alternative Gene Names: ERLEC2, OS-9, Validated applications: IHC, Uniprot ID: Q13438, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name OS9
Gene Description osteosarcoma amplified 9, endoplasmic reticulum lectin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKML
Immunogen PLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKML
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ERLEC2, OS-9
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13438
HTS Code 3002150000
Gene ID 10956
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OS9 Antibody 25ul

Anti-OS9 Antibody 25ul