MAGI2,ACVRIP1,AIP1
  • MAGI2,ACVRIP1,AIP1

Anti-MAGI2 Antibody 25ul

Ref: AN-HPA013650-25ul
Anti-MAGI2

Información del producto

Polyclonal Antibody against Human MAGI2, Gene description: membrane associated guanylate kinase, WW and PDZ domain containing 2, Alternative Gene Names: ACVRIP1, AIP1, ARIP1, KIAA0705, MAGI-2, Validated applications: IHC, Uniprot ID: Q86UL8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAGI2
Gene Description membrane associated guanylate kinase, WW and PDZ domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEMA
Immunogen AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEMA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ACVRIP1, AIP1, ARIP1, KIAA0705, MAGI-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86UL8
HTS Code 3002150000
Gene ID 9863
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAGI2 Antibody 25ul

Anti-MAGI2 Antibody 25ul