WBSCR17,GalNAc-T5L
  • WBSCR17,GalNAc-T5L

Anti-WBSCR17 Antibody 100ul

Ref: AN-HPA013624-100ul
Anti-WBSCR17

Información del producto

Polyclonal Antibody against Human WBSCR17, Gene description: Williams-Beuren syndrome chromosome region 17, Alternative Gene Names: GalNAc-T5L, GALNTL3, Validated applications: IHC, WB, Uniprot ID: Q6IS24, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WBSCR17
Gene Description Williams-Beuren syndrome chromosome region 17
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence RPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE
Immunogen RPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GalNAc-T5L, GALNTL3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6IS24
HTS Code 3002150000
Gene ID 64409
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WBSCR17 Antibody 100ul

Anti-WBSCR17 Antibody 100ul