UBAC2,FLJ30548
  • UBAC2,FLJ30548

Anti-UBAC2 Antibody 100ul

Ref: AN-HPA013448-100ul
Anti-UBAC2

Información del producto

Polyclonal Antibody against Human UBAC2, Gene description: UBA domain containing 2, Alternative Gene Names: FLJ30548, PHGDHL1, RP11-178C10.1, Validated applications: IHC, WB, Uniprot ID: Q8NBM4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UBAC2
Gene Description UBA domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence YDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLN
Immunogen YDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ30548, PHGDHL1, RP11-178C10.1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NBM4
HTS Code 3002150000
Gene ID 337867
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UBAC2 Antibody 100ul

Anti-UBAC2 Antibody 100ul