APC,DP2,DP2.5,DP3
  • APC,DP2,DP2.5,DP3

Anti-APC Antibody 100ul

Ref: AN-HPA013349-100ul
Anti-APC

Información del producto

Polyclonal Antibody against Human APC, Gene description: adenomatous polyposis coli, Alternative Gene Names: DP2, DP2.5, DP3, PPP1R46, Validated applications: IHC, Uniprot ID: P25054, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name APC
Gene Description adenomatous polyposis coli
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
Immunogen DNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DP2, DP2.5, DP3, PPP1R46
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P25054
HTS Code 3002150000
Gene ID 324
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-APC Antibody 100ul

Anti-APC Antibody 100ul