PCDHB5
  • PCDHB5

Anti-PCDHB5 Antibody 25ul

Ref: AN-HPA013191-25ul
Anti-PCDHB5

Información del producto

Polyclonal Antibody against Human PCDHB5, Gene description: protocadherin beta 5, Alternative Gene Names: DKFZp586B0217, PCDH-BETA5, Validated applications: IHC, Uniprot ID: Q9Y5E4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PCDHB5
Gene Description protocadherin beta 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HYKGNKELLQLDIKTGNLLLYEKLDREVMCGATEPCILHFQLLLENPVQFFQTDLQLTDINDHAPEFPEKEMLLKIPESTQPGTVFPLKIAQDFDIGSNTVQNY
Immunogen HYKGNKELLQLDIKTGNLLLYEKLDREVMCGATEPCILHFQLLLENPVQFFQTDLQLTDINDHAPEFPEKEMLLKIPESTQPGTVFPLKIAQDFDIGSNTVQNY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp586B0217, PCDH-BETA5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5E4
HTS Code 3002150000
Gene ID 26167
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PCDHB5 Antibody 25ul

Anti-PCDHB5 Antibody 25ul