GALNT18,GalNAc-T18
  • GALNT18,GalNAc-T18

Anti-GALNT18 Antibody 25ul

Ref: AN-HPA012955-25ul
Anti-GALNT18

Información del producto

Polyclonal Antibody against Human GALNT18, Gene description: polypeptide N-acetylgalactosaminyltransferase 18, Alternative Gene Names: GalNAc-T18, GALNT15, GALNTL4, MGC71806, Validated applications: ICC, IHC, Uniprot ID: Q6P9A2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GALNT18
Gene Description polypeptide N-acetylgalactosaminyltransferase 18
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SDIIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRLIECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVL
Immunogen SDIIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRLIECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GalNAc-T18, GALNT15, GALNTL4, MGC71806
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P9A2
HTS Code 3002150000
Gene ID 374378
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GALNT18 Antibody 25ul

Anti-GALNT18 Antibody 25ul