CHST10,HNK-1ST
  • CHST10,HNK-1ST

Anti-CHST10 Antibody 25ul

Ref: AN-HPA012884-25ul
Anti-CHST10

Información del producto

Polyclonal Antibody against Human CHST10, Gene description: carbohydrate sulfotransferase 10, Alternative Gene Names: HNK-1ST, Validated applications: IHC, WB, Uniprot ID: O43529, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CHST10
Gene Description carbohydrate sulfotransferase 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence PEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRL
Immunogen PEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HNK-1ST
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43529
HTS Code 3002150000
Gene ID 9486
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CHST10 Antibody 25ul

Anti-CHST10 Antibody 25ul