HTR2B,5-HT(2B)
  • HTR2B,5-HT(2B)

Anti-HTR2B Antibody 100ul

Ref: AN-HPA012867-100ul
Anti-HTR2B

Información del producto

Polyclonal Antibody against Human HTR2B, Gene description: 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled, Alternative Gene Names: 5-HT(2B), 5-HT2B, Validated applications: ICC, IHC, Uniprot ID: P41595, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HTR2B
Gene Description 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL
Immunogen TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 5-HT(2B), 5-HT2B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P41595
HTS Code 3002150000
Gene ID 3357
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HTR2B Antibody 100ul

Anti-HTR2B Antibody 100ul