STBD1,FLJ41801
  • STBD1,FLJ41801

Anti-STBD1 Antibody 100ul

Ref: AN-HPA012849-100ul
Anti-STBD1

Información del producto

Polyclonal Antibody against Human STBD1, Gene description: starch binding domain 1, Alternative Gene Names: FLJ41801, GENX-3414, Validated applications: IHC, Uniprot ID: O95210, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STBD1
Gene Description starch binding domain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence APVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWW
Immunogen APVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ41801, GENX-3414
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95210
HTS Code 3002150000
Gene ID 8987
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-STBD1 Antibody 100ul

Anti-STBD1 Antibody 100ul