EPHX3,ABHD9,FLJ22408
  • EPHX3,ABHD9,FLJ22408

Anti-EPHX3 Antibody 25ul

Ref: AN-HPA012842-25ul
Anti-EPHX3

Información del producto

Polyclonal Antibody against Human EPHX3, Gene description: epoxide hydrolase 3, Alternative Gene Names: ABHD9, FLJ22408, Validated applications: IHC, Uniprot ID: Q9H6B9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EPHX3
Gene Description epoxide hydrolase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SELEAFLYNFSQPGGLTGPLNYYRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQYMWAFLQDLLD
Immunogen SELEAFLYNFSQPGGLTGPLNYYRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQYMWAFLQDLLD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABHD9, FLJ22408
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H6B9
HTS Code 3002150000
Gene ID 79852
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EPHX3 Antibody 25ul

Anti-EPHX3 Antibody 25ul