FNDC3A,bA203I16.5
  • FNDC3A,bA203I16.5

Anti-FNDC3A Antibody 100ul

Ref: AN-HPA012825-100ul
Anti-FNDC3A

Información del producto

Polyclonal Antibody against Human FNDC3A, Gene description: fibronectin type III domain containing 3A, Alternative Gene Names: bA203I16.5, FNDC3, KIAA0970, Validated applications: IHC, Uniprot ID: Q9Y2H6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FNDC3A
Gene Description fibronectin type III domain containing 3A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKV
Immunogen VNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA203I16.5, FNDC3, KIAA0970
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2H6
HTS Code 3002150000
Gene ID 22862
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FNDC3A Antibody 100ul

Anti-FNDC3A Antibody 100ul