ANKK1,X-kinase
  • ANKK1,X-kinase

Anti-ANKK1 Antibody 100ul

Ref: AN-HPA012813-100ul
Anti-ANKK1

Información del producto

Polyclonal Antibody against Human ANKK1, Gene description: ankyrin repeat and kinase domain containing 1, Alternative Gene Names: X-kinase, Validated applications: IHC, Uniprot ID: Q8NFD2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ANKK1
Gene Description ankyrin repeat and kinase domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER
Immunogen EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names X-kinase
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NFD2
HTS Code 3002150000
Gene ID 255239
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ANKK1 Antibody 100ul

Anti-ANKK1 Antibody 100ul