EML2,ELP70,EMAP-2
  • EML2,ELP70,EMAP-2

Anti-EML2 Antibody 100ul

Ref: AN-HPA012757-100ul
Anti-EML2

Información del producto

Polyclonal Antibody against Human EML2, Gene description: echinoderm microtubule associated protein like 2, Alternative Gene Names: ELP70, EMAP-2, EMAP2, Validated applications: IHC, WB, Uniprot ID: O95834, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EML2
Gene Description echinoderm microtubule associated protein like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPSGSVLAVG
Immunogen VLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPSGSVLAVG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ELP70, EMAP-2, EMAP2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95834
HTS Code 3002150000
Gene ID 24139
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EML2 Antibody 100ul

Anti-EML2 Antibody 100ul