FGF3,HBGF-3,INT2
  • FGF3,HBGF-3,INT2

Anti-FGF3 Antibody 25ul

Ref: AN-HPA012692-25ul
Anti-FGF3

Información del producto

Polyclonal Antibody against Human FGF3, Gene description: fibroblast growth factor 3, Alternative Gene Names: HBGF-3, INT2, Validated applications: IHC, Uniprot ID: P11487, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FGF3
Gene Description fibroblast growth factor 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPS
Immunogen RGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HBGF-3, INT2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P11487
HTS Code 3002150000
Gene ID 2248
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FGF3 Antibody 25ul

Anti-FGF3 Antibody 25ul