PLA2R1,CLEC13C
  • PLA2R1,CLEC13C

Anti-PLA2R1 Antibody 100ul

Ref: AN-HPA012657-100ul
Anti-PLA2R1

Información del producto

Polyclonal Antibody against Human PLA2R1, Gene description: phospholipase A2 receptor 1, 180kDa, Alternative Gene Names: CLEC13C, PLA2-R, PLA2G1R, PLA2IR, Validated applications: IHC, WB, Uniprot ID: Q13018, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PLA2R1
Gene Description phospholipase A2 receptor 1, 180kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Immunogen EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CLEC13C, PLA2-R, PLA2G1R, PLA2IR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13018
HTS Code 3002150000
Gene ID 22925
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PLA2R1 Antibody 100ul

Anti-PLA2R1 Antibody 100ul