PAWR,par-4,PAR4
  • PAWR,par-4,PAR4

Anti-PAWR Antibody 100ul

Ref: AN-HPA012640-100ul
Anti-PAWR

Información del producto

Polyclonal Antibody against Human PAWR, Gene description: PRKC, apoptosis, WT1, regulator, Alternative Gene Names: par-4, PAR4, Validated applications: ICC, IHC, WB, Uniprot ID: Q96IZ0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PAWR
Gene Description PRKC, apoptosis, WT1, regulator
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT
Immunogen LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names par-4, PAR4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96IZ0
HTS Code 3002150000
Gene ID 5074
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PAWR Antibody 100ul

Anti-PAWR Antibody 100ul