RHOT2,ARHT2
  • RHOT2,ARHT2

Anti-RHOT2 Antibody 25ul

Ref: AN-HPA012624-25ul
Anti-RHOT2

Información del producto

Polyclonal Antibody against Human RHOT2, Gene description: ras homolog family member T2, Alternative Gene Names: ARHT2, C16orf39, MIRO-2, Validated applications: ICC, IHC, WB, Uniprot ID: Q8IXI1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RHOT2
Gene Description ras homolog family member T2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC
Immunogen RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARHT2, C16orf39, MIRO-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IXI1
HTS Code 3002150000
Gene ID 89941
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RHOT2 Antibody 25ul

Anti-RHOT2 Antibody 25ul