SIGLEC8,MGC59785
  • SIGLEC8,MGC59785

Anti-SIGLEC8 Antibody 100ul

Ref: AN-HPA012556-100ul
Anti-SIGLEC8

Información del producto

Polyclonal Antibody against Human SIGLEC8, Gene description: sialic acid binding Ig-like lectin 8, Alternative Gene Names: MGC59785, SAF2, SIGLEC-8, SIGLEC8L, Validated applications: IHC, WB, Uniprot ID: Q9NYZ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SIGLEC8
Gene Description sialic acid binding Ig-like lectin 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence RSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTESWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRETAETQACLRNHNPSSKEVRG
Immunogen RSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTESWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRETAETQACLRNHNPSSKEVRG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC59785, SAF2, SIGLEC-8, SIGLEC8L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NYZ4
HTS Code 3002150000
Gene ID 27181
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SIGLEC8 Antibody 100ul

Anti-SIGLEC8 Antibody 100ul