EXOG,ENDOGL1
  • EXOG,ENDOGL1

Anti-EXOG Antibody 100ul

Ref: AN-HPA012531-100ul
Anti-EXOG

Información del producto

Polyclonal Antibody against Human EXOG, Gene description: exo/endonuclease G, Alternative Gene Names: ENDOGL1, ENDOGL2, ENGL, ENGL-a, ENGL-b, Validated applications: IHC, WB, Uniprot ID: Q9Y2C4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EXOG
Gene Description exo/endonuclease G
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIR
Immunogen VIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ENDOGL1, ENDOGL2, ENGL, ENGL-a, ENGL-b
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2C4
HTS Code 3002150000
Gene ID 9941
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EXOG Antibody 100ul

Anti-EXOG Antibody 100ul