DHRS7B,CGI-93
  • DHRS7B,CGI-93

Anti-DHRS7B Antibody 25ul

Ref: AN-HPA012132-25ul
Anti-DHRS7B

Información del producto

Polyclonal Antibody against Human DHRS7B, Gene description: dehydrogenase/reductase (SDR family) member 7B, Alternative Gene Names: CGI-93, DKFZp566O084, MGC8916, SDR32C1, Validated applications: IHC, WB, Uniprot ID: Q6IAN0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DHRS7B
Gene Description dehydrogenase/reductase (SDR family) member 7B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAVGKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKERKSKNS
Immunogen ATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAVGKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKERKSKNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-93, DKFZp566O084, MGC8916, SDR32C1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6IAN0
HTS Code 3002150000
Gene ID 25979
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DHRS7B Antibody 25ul

Anti-DHRS7B Antibody 25ul