LASP1,Lasp-1,MLN50
  • LASP1,Lasp-1,MLN50

Anti-LASP1 Antibody 25ul

Ref: AN-HPA012072-25ul
Anti-LASP1

Información del producto

Polyclonal Antibody against Human LASP1, Gene description: LIM and SH3 protein 1, Alternative Gene Names: Lasp-1, MLN50, Validated applications: ICC, IHC, WB, Uniprot ID: Q14847, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LASP1
Gene Description LIM and SH3 protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence ADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKE
Immunogen ADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Lasp-1, MLN50
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14847
HTS Code 3002150000
Gene ID 3927
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LASP1 Antibody 25ul

Anti-LASP1 Antibody 25ul