LILRB5,CD85c,LIR-8
  • LILRB5,CD85c,LIR-8

Anti-LILRB5 Antibody 25ul

Ref: AN-HPA012069-25ul
Anti-LILRB5

Información del producto

Polyclonal Antibody against Human LILRB5, Gene description: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5, Alternative Gene Names: CD85c, LIR-8, LIR8, Validated applications: IHC, Uniprot ID: O75023, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LILRB5
Gene Description leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG
Immunogen PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD85c, LIR-8, LIR8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75023
HTS Code 3002150000
Gene ID 10990
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LILRB5 Antibody 25ul

Anti-LILRB5 Antibody 25ul