ERBB4,ALS19
  • ERBB4,ALS19

Anti-ERBB4 Antibody 100ul

Ref: AN-HPA012016-100ul
Anti-ERBB4

Información del producto

Polyclonal Antibody against Human ERBB4, Gene description: v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4, Alternative Gene Names: ALS19, Validated applications: IHC, Uniprot ID: Q15303, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ERBB4
Gene Description v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRK
Immunogen LPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALS19
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15303
HTS Code 3002150000
Gene ID 2066
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ERBB4 Antibody 100ul

Anti-ERBB4 Antibody 100ul