C3orf52,FLJ23186
  • C3orf52,FLJ23186

Anti-C3orf52 Antibody 100ul

Ref: AN-HPA011968-100ul
Anti-C3orf52

Información del producto

Polyclonal Antibody against Human C3orf52, Gene description: chromosome 3 open reading frame 52, Alternative Gene Names: FLJ23186, TTMP, Validated applications: IHC, Uniprot ID: Q5BVD1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C3orf52
Gene Description chromosome 3 open reading frame 52
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LSSNKTFFIMLKIPEECVAEEELPHLLTERLTDVYSTSPSLSRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKYMMSEELVLGILLQDFRDQNIPGCESLGLDP
Immunogen LSSNKTFFIMLKIPEECVAEEELPHLLTERLTDVYSTSPSLSRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKYMMSEELVLGILLQDFRDQNIPGCESLGLDP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ23186, TTMP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5BVD1
HTS Code 3002150000
Gene ID 79669
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C3orf52 Antibody 100ul

Anti-C3orf52 Antibody 100ul