RRBP1,ES/130,hES
  • RRBP1,ES/130,hES

Anti-RRBP1 Antibody 100ul

Ref: AN-HPA011924-100ul
Anti-RRBP1

Información del producto

Polyclonal Antibody against Human RRBP1, Gene description: ribosome binding protein 1, Alternative Gene Names: ES/130, hES, Validated applications: ICC, IHC, WB, Uniprot ID: Q9P2E9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RRBP1
Gene Description ribosome binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence QLCLIEAQTMEALLALLPELSVLAQQNYTEWLQDLKEKGPTLLKHPPAPAEPSSDLASKLREAEETQSTLQAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLE
Immunogen QLCLIEAQTMEALLALLPELSVLAQQNYTEWLQDLKEKGPTLLKHPPAPAEPSSDLASKLREAEETQSTLQAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ES/130, hES
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2E9
HTS Code 3002150000
Gene ID 6238
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RRBP1 Antibody 100ul

Anti-RRBP1 Antibody 100ul