CD151,PETA-3,RAPH
  • CD151,PETA-3,RAPH

Anti-CD151 Antibody 25ul

Ref: AN-HPA011906-25ul
Anti-CD151

Información del producto

Polyclonal Antibody against Human CD151, Gene description: CD151 molecule (Raph blood group), Alternative Gene Names: PETA-3, RAPH, SFA-1, TSPAN24, Validated applications: IHC, Uniprot ID: P48509, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CD151
Gene Description CD151 molecule (Raph blood group)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETF
Immunogen LNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PETA-3, RAPH, SFA-1, TSPAN24
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P48509
HTS Code 3002150000
Gene ID 977
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CD151 Antibody 25ul

Anti-CD151 Antibody 25ul