DOT1L,DOT1,KIAA1814
  • DOT1L,DOT1,KIAA1814

Anti-DOT1L Antibody 25ul

Ref: AN-HPA011875-25ul
Anti-DOT1L

Información del producto

Polyclonal Antibody against Human DOT1L, Gene description: DOT1-like histone H3K79 methyltransferase, Alternative Gene Names: DOT1, KIAA1814, KMT4, Validated applications: ICC, Uniprot ID: Q8TEK3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DOT1L
Gene Description DOT1-like histone H3K79 methyltransferase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LLKARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLKSCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTKFSLPHLSSMSPELSMNGQAAGYELCGVLSRPSSKQNTPQYLASPLDQ
Immunogen LLKARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLKSCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTKFSLPHLSSMSPELSMNGQAAGYELCGVLSRPSSKQNTPQYLASPLDQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DOT1, KIAA1814, KMT4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TEK3
HTS Code 3002150000
Gene ID 84444
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DOT1L Antibody 25ul

Anti-DOT1L Antibody 25ul