PCDH7,BH-Pcdh
  • PCDH7,BH-Pcdh

Anti-PCDH7 Antibody 100ul

Ref: AN-HPA011866-100ul
Anti-PCDH7

Información del producto

Polyclonal Antibody against Human PCDH7, Gene description: protocadherin 7, Alternative Gene Names: BH-Pcdh, PPP1R120, Validated applications: IHC, Uniprot ID: O60245, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PCDH7
Gene Description protocadherin 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPT
Immunogen SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BH-Pcdh, PPP1R120
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60245
HTS Code 3002150000
Gene ID 5099
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PCDH7 Antibody 100ul

Anti-PCDH7 Antibody 100ul