LRIG1,DKFZP586O1624
  • LRIG1,DKFZP586O1624

Anti-LRIG1 Antibody 25ul

Ref: AN-HPA011846-25ul
Anti-LRIG1

Información del producto

Polyclonal Antibody against Human LRIG1, Gene description: leucine-rich repeats and immunoglobulin-like domains 1, Alternative Gene Names: DKFZP586O1624, LIG-1, LIG1, Validated applications: ICC, IHC, WB, Uniprot ID: Q96JA1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LRIG1
Gene Description leucine-rich repeats and immunoglobulin-like domains 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence TRKKSEEYSVTNTDETVVPPDVPSYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAGSAYHKEPWKAMEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYS
Immunogen TRKKSEEYSVTNTDETVVPPDVPSYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAGSAYHKEPWKAMEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP586O1624, LIG-1, LIG1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96JA1
HTS Code 3002150000
Gene ID 26018
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LRIG1 Antibody 25ul

Anti-LRIG1 Antibody 25ul